PDB entry 1uq5

View 1uq5 on RCSB PDB site
Description: ricin a-chain (recombinant) n122a mutant
Class: hydrolase
Keywords: hydrolase, glycosidase, toxin, glycoprotein
Deposited on 2003-10-15, released 2004-01-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02879 (0-262)
      • engineered mutation (113)
    Domains in SCOPe 2.04: d1uq5a_
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uq5A (A:)
    qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
    haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggayd
    rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
    egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
    vsilipiialmvyrcapppssqf