PDB entry 1up1

View 1up1 on RCSB PDB site
Description: up1, the two RNA-recognition motif domain of hnrnp a1
Class: nuclear protein
Keywords: nuclear proteinhnrnp a1, RNA-recognition motif, RNA-binding, up1
Deposited on 1997-03-12, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up1a1, d1up1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up1A (A:)
    ksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvty
    atveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlr
    dyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkals
    kq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up1A (A:)
    pkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatve
    evdaamnarphkvdgrvvepkravsrgahltvkkifvggikedteehhlrdyfeqygkie
    vieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkals