PDB entry 1uks

View 1uks on RCSB PDB site
Description: Crystal structure of F183L/F259L mutant cyclodextrin glucanotransferase complexed with a pseudo-maltotetraose derived from acarbose
Class: transferase
Keywords: cgtase, acarbose, carbohydrate/protein interaction, transferase
Deposited on 2003-09-01, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (182)
      • engineered (258)
      • see remark 999 (451)
      • see remark 999 (453)
    Domains in SCOPe 2.07: d1uksa1, d1uksa2, d1uksa3, d1uksa4
  • Chain 'B':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (182)
      • engineered (258)
      • see remark 999 (451)
      • see remark 999 (453)
    Domains in SCOPe 2.07: d1uksb1, d1uksb2, d1uksb3, d1uksb4
  • Heterogens: GLC, ACI, GLD, GAL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uksA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdlstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewllgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uksB (B:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdlstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewllgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp