![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries) |
![]() | Domain d1uksa4: 1uks A:1-406 [99520] Other proteins in same PDB: d1uksa1, d1uksa2, d1uksa3, d1uksb1, d1uksb2, d1uksb3 complexed with aci, ca, glc; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1uks (more details), 1.9 Å
SCOPe Domain Sequences for d1uksa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uksa4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg tdlstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk sfmatinnykpvftfgewllgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1uksa4:
![]() Domains from other chains: (mouse over for more information) d1uksb1, d1uksb2, d1uksb3, d1uksb4 |