PDB entry 1ujy

View 1ujy on RCSB PDB site
Description: Solution structure of SH3 domain in Rac/Cdc42 guanine nucleotide exchange factor(GEF) 6
Class: signaling protein
Keywords: NMR, structural genomics, SH3 domain, GEF 6, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-08-12, released 2004-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA ha01154
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15052 (7-69)
      • cloning artifact (0-6)
      • cloning artifact (70-75)
    Domains in SCOPe 2.07: d1ujya1, d1ujya2, d1ujya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujyA (A:)
    gssgssgshqlivkarfnfkqtnedelsvckgdiiyvtrveeggwwegtlngrtgwfpsn
    yvreikssersgpssg