PDB entry 1ujd

View 1ujd on RCSB PDB site
Description: solution structure of rsgi ruh-003, a pdz domain of hypothetical kiaa0559 protein from human cdna
Deposited on 2003-07-31, released 2004-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-31, with a file datestamp of 2004-01-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ujda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujdA (A:)
    gssgssghyifpharikitrdskdhtvsgnglgirivggkeipghsgeigayiakilpgg
    saeqtgklmegmqvlewngipltsktyeevqsiisqqsgeaeicvrldlnmsgpssg