Lineage for d1ujda_ (1ujd A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462260Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 462261Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 462262Family b.36.1.1: PDZ domain [50157] (29 proteins)
    Pfam 00595
  6. 462307Protein Hypothetical protein KIAA0559 [101727] (1 species)
  7. 462308Species Human (Homo sapiens) [TaxId:9606] [101728] (1 PDB entry)
  8. 462309Domain d1ujda_: 1ujd A: [99454]
    structural genomics; Rsgi Ruh-003 domain

Details for d1ujda_

PDB Entry: 1ujd (more details)

PDB Description: solution structure of rsgi ruh-003, a pdz domain of hypothetical kiaa0559 protein from human cdna

SCOP Domain Sequences for d1ujda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens)}
gssgssghyifpharikitrdskdhtvsgnglgirivggkeipghsgeigayiakilpgg
saeqtgklmegmqvlewngipltsktyeevqsiisqqsgeaeicvrldlnmsgpssg

SCOP Domain Coordinates for d1ujda_:

Click to download the PDB-style file with coordinates for d1ujda_.
(The format of our PDB-style files is described here.)

Timeline for d1ujda_: