PDB entry 1uiy

View 1uiy on RCSB PDB site
Description: Crystal Structure of Enoyl-CoA Hydratase from Thermus Thermophilus HB8
Class: Lyase
Keywords: Lyase, beta-oxidation, crotonase, CoA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-07-24, released 2003-08-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1uiya_
  • Heterogens: DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uiyA (A:)
mvqvekghvavvflndperrnplspemalsllqalddleadpgvravvltgrgkafsaga
dlaflervtelgaeenyrhslslmrlfhrvytypkptvaavngpavaggaglalacdlvv
mdeearlgytevkigfvaalvsvilvravgekaakdllltgrlveareakalglvnriap
pgkaleeakalaeevaknaptslrltkelllalpgmgledgfrlaalanawvretgdlae
giraffekrpprf