PDB entry 1uil

View 1uil on RCSB PDB site
Description: Double-stranded RNA-binding motif of Hypothetical protein BAB28848
Class: RNA binding protein
Keywords: Structural genomics, Double-stranded RNA-binding motif, DSRM, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2003-07-17, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Double-stranded RNA-binding motif
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2810480H04
  Database cross-references and differences (RAF-indexed):
  • Uniprot O70133 (7-106)
    • cloning artifact (0-6)
    • cloning artifact (107-112)
  Domains in SCOPe 2.08: d1uila1, d1uila2, d1uila3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uilA (A:)
  gssgssgleseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfia
  emtiyikqlgrrifarehgsnkklaaqscalslvrqlyhlgvieayssgpssg