Lineage for d1uila1 (1uil A:8-107)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946842Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
    formerly hypothetical protein bab28848
  7. 2946843Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)
    Uniprot O70133 4-89, 168-262
  8. 2946845Domain d1uila1: 1uil A:8-107 [113255]
    Other proteins in same PDB: d1uila2, d1uila3
    Structural genomics target; 2nd dsRDB

Details for d1uila1

PDB Entry: 1uil (more details)

PDB Description: double-stranded rna-binding motif of hypothetical protein bab28848
PDB Compounds: (A:) Double-stranded RNA-binding motif

SCOPe Domain Sequences for d1uila1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uila1 d.50.1.1 (A:8-107) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]}
leseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfiaemtiyik
qlgrrifarehgsnkklaaqscalslvrqlyhlgvieays

SCOPe Domain Coordinates for d1uila1:

Click to download the PDB-style file with coordinates for d1uila1.
(The format of our PDB-style files is described here.)

Timeline for d1uila1: