PDB entry 1uhp

View 1uhp on RCSB PDB site
Description: Solution structure of RSGI RUH-005, a PDZ domain in human cDNA, KIAA1095
Class: structural genomics, unknown function
Keywords: NMR, PDZ domain, Semaphorin cytoplasmic domain associated protein, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-07-09, released 2004-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein KIAA1095
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1095
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPQ7 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.08: d1uhpa1, d1uhpa2, d1uhpa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhpA (A:)
    gssgssgksltlvlhrdsgslgfniiggrpsvdnhdgsssegifvskivdsgpaakeggl
    qihdriievngrdlsrathdqaveafktakepivvqvlrrtsgpssg