Lineage for d1uhpa1 (1uhp A:8-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785967Protein Hypothetical protein KIAA1095 [101723] (1 species)
  7. 2785968Species Human (Homo sapiens) [TaxId:9606] [101724] (2 PDB entries)
    Uniprot Q9UPQ7 246-339, 404-512
  8. 2785969Domain d1uhpa1: 1uhp A:8-101 [99400]
    Other proteins in same PDB: d1uhpa2, d1uhpa3
    structural genomics; Rsgi Ruh-005 domain

Details for d1uhpa1

PDB Entry: 1uhp (more details)

PDB Description: solution structure of rsgi ruh-005, a pdz domain in human cdna, kiaa1095
PDB Compounds: (A:) hypothetical protein KIAA1095

SCOPe Domain Sequences for d1uhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhpa1 b.36.1.1 (A:8-101) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}
ksltlvlhrdsgslgfniiggrpsvdnhdgsssegifvskivdsgpaakegglqihdrii
evngrdlsrathdqaveafktakepivvqvlrrt

SCOPe Domain Coordinates for d1uhpa1:

Click to download the PDB-style file with coordinates for d1uhpa1.
(The format of our PDB-style files is described here.)

Timeline for d1uhpa1: