SCOPe 2.02: Structural Classification of Proteins

PDB entry 1ugi

View 1ugi on RCSB PDB site
Description: uracil-DNA glycosylase inhibitor protein
Class: hydrolase inhibitor
Keywords: protein mimicry of DNA, protein inhibitor, hydrolase inhibitor
Deposited on 1998-11-04, released 1999-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.222
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugia_
Chain 'B':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugib_
Chain 'C':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugic_
Chain 'D':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugid_
Chain 'E':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugie_
Chain 'F':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugif_
Chain 'G':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugig_
Chain 'H':
Compound: uracil-DNA glycosylase inhibitor
Species: Bacillus phage PBS2 [TaxId:10684]
Database cross-references and differences (RAF-indexed):
- Uniprot P14739 (Start-83)
Domains in SCOPe 2.02: d1ugih_
Heterogens: SO4, IMD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1ugiA (A:)
mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
dapeykpwalviqdsngenkikml