PDB entry 1ug2

View 1ug2 on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain
Class: Structural genomics, unknown function
Keywords: hypothetical protein, myb-like DNA binding domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-06-11, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2610100B20Rik gene product
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610100B20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ug2a1, d1ug2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug2A (A:)
    gpsgssgagalpkaseatvcannskvsstgekvvlwtreadrviltmcqeqgaqphtfsv
    isqqlgnktpvevshrfrelmqlfhtacesgpssg