PDB entry 1ug0

View 1ug0 on RCSB PDB site
Description: Solution structure of SURP domain in BAB30904
Class: RNA binding protein
Keywords: NMR, SURP domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-06-11, released 2004-08-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: splicing factor 4
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 5730496N02
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CH02 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOP 1.73: d1ug0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ug0A (A:)
  gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
  flhdknsreflyyrrkvaeirksgpssg