Lineage for d1ug0a_ (1ug0 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651392Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
    5 helices: irregular array
  4. 651393Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family) (S)
  5. 651394Family a.217.1.1: Surp module (SWAP domain) [109906] (1 protein)
    Pfam PF01805
  6. 651395Protein Splicing factor 4 [109907] (1 species)
  7. 651396Species Mouse (Mus musculus) [TaxId:10090] [109908] (1 PDB entry)
  8. 651397Domain d1ug0a_: 1ug0 A: [107822]
    Structural genomics target

Details for d1ug0a_

PDB Entry: 1ug0 (more details)

PDB Description: solution structure of surp domain in bab30904
PDB Compounds: (A:) splicing factor 4

SCOP Domain Sequences for d1ug0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug0a_ a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
flhdknsreflyyrrkvaeirksgpssg

SCOP Domain Coordinates for d1ug0a_:

Click to download the PDB-style file with coordinates for d1ug0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ug0a_: