PDB entry 1ufa

View 1ufa on RCSB PDB site
Description: Crystal structure of TT1467 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-05-28, released 2003-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TT1467 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufaa1, d1ufaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufaA (A:)
    marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
    pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
    sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
    wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspygeaa
    lgpvesqeatyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhh
    wrvthrkadlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghw
    wyegvawleavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrvwlnektld
    ywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaeayareryee
    haraffhllkgaspeelraleerdnpfpeadprlylfrea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufaA (A:)
    marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
    pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
    sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
    wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspvesqe
    atyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhhwrvthrka
    dlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghwwyegvawl
    eavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrvwlnektldywekvyra
    egamreaarrgvlpegvlrqamrelllleasdwpflmetgqaeayareryeeharaffhl
    lkgaspeelraleerdnpfpeadprlylf