PDB entry 1uaw

View 1uaw on RCSB PDB site
Description: Solution structure of the N-terminal RNA-binding domain of mouse Musashi1
Class: RNA binding protein
Keywords: RNP-type structure, RNA BINDING PROTEIN
Deposited on 2003-03-24, released 2004-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mouse-musashi-1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61474 (0-76)
  Domains in SCOPe 2.07: d1uawa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uawA (A:)
  ckmfigglswqttqeglreyfgqfgevkeclvmrdpltkrsrgfgfvtfmdqagvdkvla
  qsrheldsktidpkvaf