PDB entry 1u9u

View 1u9u on RCSB PDB site
Description: Crystal structure of F58Y mutant of cytochrome b5
Class: electron transport
Keywords: crystal structure, hemoprotein, F58Y mutant, aromatic-aromatic interactions, ELECTRON TRANSPORT
Deposited on 2004-08-11, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
    • engineered (55)
  Domains in SCOPe 2.07: d1u9ua_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u9uA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenyedvg
  hstdarelsktfiigelhpddr