PDB entry 1u9l
View 1u9l on RCSB PDB site
Description: Structural basis for a NusA- protein N interaction
Class: RNA binding protein
Keywords: Escherichia coli NusA, Phage lambda protein N, Regulation of RNA binding, Transcription antitermination, X-ray crystallography, RNA BINDING PROTEIN
Deposited on
2004-08-10, released
2004-08-31
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Transcription elongation protein nusA
Species: Escherichia coli [TaxId:562]
Gene: nusA
Database cross-references and differences (RAF-indexed):
- Uniprot P03003 (0-End)
- PDB 1U9L (0-End)
Domains in SCOPe 2.04: d1u9la_ - Chain 'B':
Compound: Transcription elongation protein nusA
Species: Escherichia coli [TaxId:562]
Gene: nusA
Database cross-references and differences (RAF-indexed):
- Uniprot P03003 (0-69)
- PDB 1U9L (0-69)
Domains in SCOPe 2.04: d1u9lb_ - Chain 'C':
Compound: Lambda N
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: AU, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1u9lA (A:)
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq
Sequence, based on observed residues (ATOM records): (download)
>1u9lA (A:)
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1u9lB (B:)
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq
- Chain 'C':
No sequence available.