PDB entry 1u9k

View 1u9k on RCSB PDB site
Description: Crystal Structure of Mouse Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.76
Class: immune system
Keywords: activating receptors, TREM-1, innate immunity, immune system receptor, IMMUNE SYSTEM
Deposited on 2004-08-09, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.226
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Mus musculus [TaxId:10090]
    Gene: trem
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9ka_
  • Chain 'B':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Mus musculus [TaxId:10090]
    Gene: trem
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9kb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9kA (A:)
    aivleeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsev
    hmgkftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9kA (A:)
    eeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsevhmgk
    ftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u9kB (B:)
    aivleeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsev
    hmgkftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9kB (B:)
    eeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsevhmgk
    ftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt