![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117037] (1 PDB entry) Uniprot Q9JKE2 25-134 |
![]() | Domain d1u9kb_: 1u9k B: [113245] complexed with zn |
PDB Entry: 1u9k (more details), 1.76 Å
SCOPe Domain Sequences for d1u9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9kb_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} eeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsevhmgk ftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt
Timeline for d1u9kb_: