PDB entry 1u87

View 1u87 on RCSB PDB site
Description: Crystal Structure Of The 26 Kda Glutathione S-Transferase Y7F mutant From Schistosoma Japonicum Complexed With Glutathione
Class: transferase
Keywords: transferase
Deposited on 2004-08-05, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-Transferase 26 kDa
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-End)
      • engineered (6)
    Domains in SCOPe 2.07: d1u87a1, d1u87a2
  • Heterogens: GSH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u87A (A:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u87A (A:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqat