SCOPe 2.08: Domain d1u87a2: 1u87 A:5-81

Lineage for d1u87a2 (1u87 A:5-81)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
   Uniprot P08515

8. Domain d1u87a2: 1u87 A:5-81 [145779]
   Other proteins in same PDB: d1u87a1
   automatically matched to d2fhea2
   complexed with gsh; mutant

Details for d1u87a2

PDB Entry: 1u87, 3.5 Å

PDB Description: crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with glutathione

PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOPe Domain Sequences for d1u87a2:

Sequence; same for both SEQRES and ATOM records:

>d1u87a2 c.47.1.5 (A:5-81) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk
ltqsmaiiryiadkhnm

Timeline for d1u87a2:

• d1u87a2 first appeared in SCOP 1.75
  
• d1u87a2 appears in SCOPe 2.07