PDB entry 1u85

View 1u85 on RCSB PDB site
Description: ARG326-TRP mutant of the third zinc finger of BKLF
Class: DNA binding protein
Keywords: zinc finger, kruppel-like, DNA BINDING PROTEIN
Deposited on 2004-08-05, released 2005-08-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kruppel-like factor 3
    Species: Mus musculus [TaxId:10090]
    Gene: BKLF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60980 (2-32)
      • cloning artifact (0-1)
      • engineered (14)
    Domains in SCOPe 2.02: d1u85a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u85A (A:)
    gstgikpfqcpdcdwsfsrsdhlalhrkrhmlv