PDB entry 1u5g

View 1u5g on RCSB PDB site
Description: Crystal Structure of the PH Domain of SKAP-Hom
Class: signaling protein
Keywords: PH Domain, SIGNALING PROTEIN
Deposited on 2004-07-27, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5ga1
  • Chain 'B':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5gb_
  • Chain 'C':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5gc_
  • Chain 'D':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5gd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5gA (A:)
    gsgnqfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqd
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5gA (A:)
    qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
    aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5gB (B:)
    gsgnqfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqd
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5gB (B:)
    qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
    aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u5gC (C:)
    gsgnqfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqd
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5gC (C:)
    qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
    aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u5gD (D:)
    gsgnqfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqd
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5gD (D:)
    qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
    aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilq