Lineage for d1u5gc_ (1u5g C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803309Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 2803310Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
    Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222
  8. 2803318Domain d1u5gc_: 1u5g C: [119545]
    automated match to d1u5ga1

Details for d1u5gc_

PDB Entry: 1u5g (more details), 2.1 Å

PDB Description: crystal structure of the ph domain of skap-hom
PDB Compounds: (C:) Src-associated adaptor protein

SCOPe Domain Sequences for d1u5gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5gc_ b.55.1.1 (C:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
qfppiaaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgef
aidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

SCOPe Domain Coordinates for d1u5gc_:

Click to download the PDB-style file with coordinates for d1u5gc_.
(The format of our PDB-style files is described here.)

Timeline for d1u5gc_: