PDB entry 1u4e

View 1u4e on RCSB PDB site
Description: Crystal Structure of Cytoplasmic Domains of GIRK1 channel
Class: metal transport
Keywords: metal transport
Deposited on 2004-07-24, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 1
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj3, GIRK1, Kga
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4eA (A:)
    prgshgkkrqrfvdkngrcnvqhgnlgsekraetlmfsehavismrdgkltlmfrvgnlr
    nshmvsaqirckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidaksp
    fydlsqrsmqteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffk
    vdysqfhatfevptppysvkeqeemllmsspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4eA (A:)
    krqrfvdkngrcnvqhgnlraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirc
    kllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqt
    eqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfe
    vptppysvkeqeemllmssp