Lineage for d1u4ea_ (1u4e A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362645Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2362663Protein automated matches [190782] (2 species)
    not a true protein
  7. 2362670Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)
  8. 2362677Domain d1u4ea_: 1u4e A: [161803]
    automated match to d1n9pa_

Details for d1u4ea_

PDB Entry: 1u4e (more details), 2.09 Å

PDB Description: crystal structure of cytoplasmic domains of girk1 channel
PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 1

SCOPe Domain Sequences for d1u4ea_:

Sequence, based on SEQRES records: (download)

>d1u4ea_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krqrfvdkngrcnvqhgnlgsekraetlmfsehavismrdgkltlmfrvgnlrnshmvsa
qirckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqr
smqteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfh
atfevptppysvkeqeemllmssp

Sequence, based on observed residues (ATOM records): (download)

>d1u4ea_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krqrfvdkngrcnvqhgnlraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirc
kllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqt
eqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfe
vptppysvkeqeemllmssp

SCOPe Domain Coordinates for d1u4ea_:

Click to download the PDB-style file with coordinates for d1u4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1u4ea_: