PDB entry 1u2v

View 1u2v on RCSB PDB site
Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
Class: structural protein
Keywords: structural protein
Deposited on 2004-07-20, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-related protein 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2va1, d1u2va2
  • Chain 'B':
    Compound: Actin-related Protein 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V
    Domains in SCOPe 2.06: d1u2vb1
  • Chain 'C':
    Compound: Arp2/3 complex 41kDa subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V (Start-371)
    Domains in SCOPe 2.06: d1u2vc_
  • Chain 'D':
    Compound: Arp2/3 complex 34kDa subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V (0-End)
    Domains in SCOPe 2.06: d1u2vd1, d1u2vd2
  • Chain 'E':
    Compound: Arp2/3 complex 21kDa subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V
    Domains in SCOPe 2.06: d1u2ve_
  • Chain 'F':
    Compound: Arp2/3 complex 20kDa subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V (Start-167)
    Domains in SCOPe 2.06: d1u2vf_
  • Chain 'G':
    Compound: Arp2/3 Complex 16kDa Subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U2V (Start-150)
    Domains in SCOPe 2.06: d1u2vg_
  • Heterogens: CA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2vA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpt
    yatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimf
    esfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipvaegyvigscik
    hipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgsk
    wikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidv
    rrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelkpkpidvqvithhmqrya
    vwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2vB (B:)
    mdsqgrkvvvcdngtgfvkcgyagsnfpehifpalvgrpiirsttkvgnieikdlmvgde
    aselrsmlevnypmengivrnwddmkhlwdytfgpeklnidtrnckillteppmnptknr
    ekivevmfetyqfsgvyvaiqavltlyaqglltgvvvdsgdgvthicpvyegfslphltr
    rldiagrditrylikllllrgyafnhsadfetvrmikeklcyvgynieqeqklalettvl
    vesytlpdgriikvggerfeapealfqphlinvegvgvaellfntiqaadidtrsefykh
    ivlsggstmypglpsrlerelkqlylervlkgdveklskfkiriedpprrkhmvflggav
    ladimkdkdnfwmtrqeyqekgvrvleklgvtvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vB (B:)
    yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
    sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
    qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
    ervlkgdveklskfkiriedpprr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2vC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vC (C:)
    ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
    pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
    icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
    ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
    setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvprgltarerfqnld
    kkaagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u2vD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u2vE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdpskwwtcfvkrqfmnksls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u2vF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vF (F:)
    atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
    iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
    teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1u2vG (G:)
    mskntvssarfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2vG (G:)
    arfrkvdvdeydenkfvdagpdegevdsclrqgnmtaalqaalknppintksqavkdrag
    sivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaag
    gvgsivrvltarktv