PDB entry 1u2b

View 1u2b on RCSB PDB site
Description: Triglycine variant of the Grp1 Pleckstrin Homology Domain unliganded
Class: lipid binding protein
Keywords: PH domain, lipid binding, phosphoinositides, LIPID BINDING PROTEIN
Deposited on 2004-07-16, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytohesin 3
    Species: Mus musculus [TaxId:10090]
    Gene: Pscd3, Grp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08967 (10-137)
      • insertion (26)
    Domains in SCOPe 2.07: d1u2ba1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2bA (A:)
    mghhhhhhgstffnpdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiip
    lenlsirevedprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeeke
    ewmksikasisrdpfydm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2bA (A:)
    tffnpdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsireve
    dprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasi
    srdpfydm