PDB entry 1u1t

View 1u1t on RCSB PDB site
Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals
Class: RNA binding protein
Keywords: Hfq, HF1, Sm-like bacterial protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2004-07-16, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1ta_
  • Chain 'B':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1tb_
  • Chain 'C':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1tc_
  • Chain 'D':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1td_
  • Chain 'E':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1te_
  • Chain 'F':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1tf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1tA (A:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tA (A:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1tB (B:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tB (B:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1tC (C:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tC (C:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1tD (D:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tD (D:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1tE (E:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tE (E:)
    kghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistv
    vpsrpvrlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1tF (F:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1tF (F:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrl