Lineage for d1u1ta_ (1u1t A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787114Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2787115Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2787123Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2787142Domain d1u1ta_: 1u1t A: [119457]
    automated match to d1hk9d_

Details for d1u1ta_

PDB Entry: 1u1t (more details), 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals
PDB Compounds: (A:) Hfq protein

SCOPe Domain Sequences for d1u1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ta_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
rpvrlp

SCOPe Domain Coordinates for d1u1ta_:

Click to download the PDB-style file with coordinates for d1u1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ta_: