PDB entry 1u0s
View 1u0s on RCSB PDB site
Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima
Class: signaling protein
Keywords: protein-protein complex, alpha/beta sandwich, signaling complex, transient interaction, transient complex of thermostable proteins, SIGNALING PROTEIN
Deposited on
2004-07-14, released
2004-08-10
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: chemotaxis protein chea
Species: Thermotoga maritima [TaxId:2336]
Gene: CHEA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1u0sa_ - Chain 'Y':
Compound: Chemotaxis protein cheY
Species: Thermotoga maritima [TaxId:2336]
Gene: cheY
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1u0sy_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1u0sA (A:)
gfktfyikvilkegtqlksariylvfhkleelkcevvrtipsveeieeekfenevelfvi
spvdleklsealssiadierviikev
- Chain 'Y':
Sequence; same for both SEQRES and ATOM records: (download)
>1u0sY (Y:)
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs