PDB entry 1u08

View 1u08 on RCSB PDB site
Description: Crystal Structure and Reactivity of YbdL from Escherichia coli Identify a Methionine Aminotransferase Function.
Class: Transferase
Keywords: ALPHA BETA PROTEIN, Transferase
Deposited on 2004-07-13, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical aminotransferase ybdL
    Species: Escherichia coli [TaxId:562]
    Gene: ybdL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u08a_
  • Chain 'B':
    Compound: Hypothetical aminotransferase ybdL
    Species: Escherichia coli [TaxId:562]
    Gene: ybdL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u08b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u08A (A:)
    mtnnplipqsklpqlgttiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqga
    nqyapmtgvqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevic
    fdpsydsyapaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvw
    qqadfaalwqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhm
    tgwkvgycvapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrd
    ilvnalnesrleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpf
    phklirlcfakkestllaaaerlrql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u08A (A:)
    plipqsklpqlgttiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqganqya
    pmtgvqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevicfdps
    ydsyapaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvwqqad
    faalwqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhmtgwk
    vgycvapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrdilvn
    alnesrleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpfphkl
    irlcfakkestllaaaerlrql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u08B (B:)
    mtnnplipqsklpqlgttiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqga
    nqyapmtgvqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevic
    fdpsydsyapaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvw
    qqadfaalwqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhm
    tgwkvgycvapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrd
    ilvnalnesrleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpf
    phklirlcfakkestllaaaerlrql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u08B (B:)
    plipqsklptiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqganqyapmtg
    vqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevicfdpsydsy
    apaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvwqqadfaal
    wqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhmtgwkvgyc
    vapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrdilvnalne
    srleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpfphklirlc
    fakkestllaaaerlrql