PDB entry 1ty4

View 1ty4 on RCSB PDB site
Description: Crystal structure of a CED-9/EGL-1 complex
Class: apoptosis
Keywords: Apoptosis, CED-9, EGL-1, Bcl-2 family proteins, recognition
Deposited on 2004-07-07, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator ced-9
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ced-9,T07C4.8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41958 (Start-169)
      • modified residue (29)
      • modified residue (47-48)
      • modified residue (51)
      • conflict (80)
      • modified residue (98)
      • modified residue (117-118)
      • modified residue (157)
      • modified residue (163)
    Domains in SCOPe 2.07: d1ty4a_
  • Chain 'B':
    Compound: Apoptosis regulator ced-9
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ced-9,T07C4.8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41958
      • modified residue (29)
      • modified residue (47-48)
      • modified residue (51)
      • conflict (80)
      • modified residue (98)
      • modified residue (117-118)
      • modified residue (157)
      • modified residue (163)
    Domains in SCOPe 2.07: d1ty4b_
  • Chain 'C':
    Compound: EGg Laying defective EGL-1, programmed cell death activator
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61667
      • modified residue (30)
      • modified residue (38-39)
  • Chain 'D':
    Compound: EGg Laying defective EGL-1, programmed cell death activator
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61667
      • modified residue (30)
      • modified residue (38-39)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ty4A (A:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkh
    aenfetfceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty4A (A:)
    eeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaenfet
    fceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesvelqg
    qvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ty4B (B:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkh
    aenfetfceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty4B (B:)
    ndweeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaen
    fetfceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesve
    lqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedye
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.