SCOPe 2.08: Domain d1ty4a_: 1ty4 A:

Lineage for d1ty4a_ (1ty4 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator ced-9 [103424] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries)
   Uniprot P41958 74-237

8. Domain d1ty4a_: 1ty4 A: [107452]
   complexed with the activator egl-1 peptide (Uniprot O61667 48-76), chains C and D

Details for d1ty4a_

PDB Entry: 1ty4, 2.2 Å

PDB Description: Crystal structure of a CED-9/EGL-1 complex

PDB Compounds: (A:) Apoptosis regulator ced-9

SCOPe Domain Sequences for d1ty4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ty4a_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
eeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaenfet
fceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesvelqg
qvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer

Timeline for d1ty4a_:

• d1ty4a_ first appeared in SCOP 1.69
  
• d1ty4a_ appears in SCOPe 2.07