PDB entry 1tuv

View 1tuv on RCSB PDB site
Description: Crystal structure of YgiN in complex with menadione
Class: unknown function
Keywords: menadione oxidase, monooxygenase, co-crystal with natural product, ferredoxin fold, UNKNOWN FUNCTION
Deposited on 2004-06-25, released 2005-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ygiN
    Species: Escherichia coli [TaxId:562]
    Gene: ygiN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tuva_
  • Heterogens: VK3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tuvA (A:)
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpgisgrvhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1tuvA (A:)
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg