PDB entry 1tpm

View 1tpm on RCSB PDB site
Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance
Class: plasminogen activator
Keywords: plasminogen activator
Deposited on 1993-05-26, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpmA (A:)
    syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks