PDB entry 1tpg

View 1tpg on RCSB PDB site
Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
Class: plasminogen activation
Keywords: plasminogen activation
Deposited on 1995-06-14, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t-plasminogen activator f1-g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00750 (0-90)
      • conflict (82)
    Domains in SCOPe 2.07: d1tpga1, d1tpga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpgA (A:)
    syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvkscseprcfngg
    tcqqalyfsdfvcqcpegfagksceidtrat