PDB entry 1tp5

View 1tp5 on RCSB PDB site
Description: Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
Class: peptide binding protein
Keywords: PDZ-peptide ligand complex, PEPTIDE BINDING PROTEIN
Deposited on 2004-06-15, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Presynaptic density protein 95
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31016 (5-105)
    • cloning artifact (4)
    • cloning artifact (106-118)
  Domains in SCOPe 2.08: d1tp5a2, d1tp5a3, d1tp5a4
• Chain 'B':
  Compound: LYS-LYS-GLU-THR-TRP-VAL peptide ligand
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1TP5 (0-5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1tp5A (A:)
  gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
  dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1tp5A (A:)
  flgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqil
  svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
  

  
  
• Chain 'B':
  No sequence available.