PDB entry 1toz

View 1toz on RCSB PDB site
Description: NMR structure of the human NOTCH-1 ligand binding region
Class: signaling protein
Keywords: notch, egf, calcium binding, ligand binding, module, signaling protein
Deposited on 2004-06-15, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (0-115)
      • engineered (66)
    Domains in SCOPe 2.08: d1toza1, d1toza2, d1toza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tozA (A:)
    qdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcldq
    igefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcq