PDB entry 1tnw

View 1tnw on RCSB PDB site
Description: nmr solution structure of calcium saturated skeletal muscle troponin c
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-08-23, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02588 (0-161)
  Domains in SCOPe 2.07: d1tnwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tnwA (A:)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
  iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
  ilratgehvieediedlmkdsdknndgridfdeflkmmegvq