PDB entry 1tnp

View 1tnp on RCSB PDB site
Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin-c (apo)
    Species: Gallus gallus [TaxId:9031]
    Gene: NTNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tnpA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda