PDB entry 1tnm

View 1tnm on RCSB PDB site
Description: tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set
Class: muscle protein
Keywords: muscle protein
Deposited on 1995-01-17, released 1995-04-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin module m5
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tnma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnmA (A:)
    mhhhhhhssriltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvttt
    kykstfeissvqasdegnysvvvensegkqeaeftltiqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnmA (A:)
    riltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkykstfeis
    svqasdegnysvvvensegkqeaeftltiqk