PDB entry 1tnk

View 1tnk on RCSB PDB site
Description: prediction of novel serine protease inhibitors
Deposited on 1994-07-21, released 1994-11-30
The last revision prior to the SCOP 1.59 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1tnk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tnk_ (-)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn