PDB entry 1tlm

View 1tlm on RCSB PDB site
Description: structural aspects of inotropic bipyridine binding: crystal structure determination to 1.9 angstroms of the human serum transthyretin- milrinone complex
Deposited on 1992-12-22, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1tlma_
  • Chain 'B':
    Domains in SCOP 1.61: d1tlmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tlmA (A:)
tgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqf
vegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
pke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tlmB (B:)
skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke