PDB entry 1tl7

View 1tl7 on RCSB PDB site
Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn
Class: lyase
Keywords: adenylyl cyclase, Gsa, MANT-GTP,, LYASE
Deposited on 2004-06-09, released 2004-12-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.254
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase, type v
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: Name=ADCY5;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30803
      • conflict (112)
    Domains in SCOPe 2.02: d1tl7a_
  • Chain 'B':
    Compound: adenylate cyclase, type II
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Name=Adcy2;
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1tl7b_
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(s), alpha subunit
    Species: Bos taurus [TaxId:9913]
    Gene: Name=GNAS; Synonyms=GNAS1;
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1tl7c1, d1tl7c2
  • Heterogens: MG, CL, MN, GSP, FOK, ONM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tl7A (A:)
    memkadinakqedmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarf
    dklaaenhclrikilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnm
    rvgihsgrvhcgvlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyeve
    pgcggernaylkehsietflilrctqkrkeekamiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl7A (A:)
    mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
    ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
    lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
    hsietflil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tl7B (B:)
    rslkneelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskp
    kfsgvekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkh
    sfndfklrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslil
    qtlgytctcrgiinvkgkgdlktyfvntemsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl7B (B:)
    hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
    tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
    vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
    dlktyfvnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tl7C (C:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfnggeggeedpnaksnsdgekatkvqdiknnlkeaietivaamsnlvppvela
    npenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfld
    kidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfnd
    vtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaek
    vlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhycy
    phftcavdtenirrvfndcrdiiqrmhlrqyellgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl7C (C:)
    athrllllgagesgkstivkqmrilhvgekatkvqdiknnlkeaietivaamsnlvppve
    lanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyf
    ldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcf
    ndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdlla
    ekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhy
    cyphftcavdtenirrvfndcrdiiqrmhl