PDB entry 1tky

View 1tky on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with seryl-3'-aminoadenosine
Class: ligase
Keywords: ligase
Deposited on 2004-06-09, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.201
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: THRS, B1719, C2116, SF1512, S1630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tkya1, d1tkya2
  • Heterogens: A3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tkyA (A:)
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
takdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveal
ekrmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvd
mcrgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa