Lineage for d1tkya2 (1tky A:63-224)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523586Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2523587Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 2523588Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)
  6. 2523589Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)
  7. 2523590Species Escherichia coli [TaxId:562] [55189] (5 PDB entries)
    Uniprot P0A8M3
  8. 2523592Domain d1tkya2: 1tky A:63-224 [112489]
    Other proteins in same PDB: d1tkya1
    protein/RNA complex; complexed with a3s

Details for d1tkya2

PDB Entry: 1tky (more details), 1.48 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with seryl-3'-aminoadenosine
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1tkya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkya2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa

SCOPe Domain Coordinates for d1tkya2:

Click to download the PDB-style file with coordinates for d1tkya2.
(The format of our PDB-style files is described here.)

Timeline for d1tkya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tkya1